FIS1 Monoclonal Antibody (M01), Clone 1G9

FIS1 Monoclonal Antibody (M01), Clone 1G9

Synonyms fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)

Packaging size: 50 µg

SKU 08A051024
Price:
$523.50
In Stock
Request a quote
Description

Product Description

Mouse monoclonal antibody raised against a full length recombinant FIS1.

Usage Statement

Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Key Applications

Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot

Specifications
SKU 08A051024
Alternate Names fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Antibody Category Monoclonal Antibodies
Antibody Research Category Apoptosis
Antibody Type Monoclonal Antibody
Clone Name 1G9
Concentration 1.0 mg/mL
Conjugate Unconjugated
Gene ID 51024
Gene Symbol and Aliases FIS1||CGI-135||TTC11
Host Mouse
Immunogen Human FIS1 (AAH03540, 1 a.a. ~ 153 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS*
Isotype IgG2b, kappa
Applications Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot
Pack Size 50 µg
Purity Purified
Research Areas Apoptosis Related Factors
Solubility Soluble in water
Species Reactivity human
Specificity Antibody Reactive Against Recombinant Protein.
Storage and Handling Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Trade Name ImmunO™
Uniprot Number AAH03540
Usage Statement Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.