Dino

Oprl1 Monoclonal Antibody (M02), Clone 2A11

Oprl1 Monoclonal Antibody (M02), Clone 2A11

Synonyms opiate receptor-like 1

Packaging size: 100 µg

SKU 08A004987
Price:
$510.70
In Stock
Request a quote
Description

Product Description

Mouse monoclonal antibody raised against a partial recombinant OPRL1.

Application Notes

Western Blots, immunoprecipitation, immunohistochemistry and immunocytochemistry procedures and ELISA

Usage Statement

Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Key Applications

Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot

Specifications
SKU 08A004987
Antibody Category Monoclonal Antibodies
Antibody Research Category Receptor
Antibody Type Monoclonal Antibody
Application Notes Western Blots, immunoprecipitation, immunohistochemistry and immunocytochemistry procedures and ELISA
Clone Name 2A11
Concentration 1 mg/ml
Conjugate Unconjugated
Formulation Details Purified
Gene ID 4987
Gene Symbol and Aliases OPRL1||KOR-3||MGC34578||NOCIR||OOR||ORL1
Host Mouse
Immunogen Human OPRL1 (AAH38433, 110 a.a. ~ 213 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence DILLGFWPFGNALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASVVGVPVAIMGSAQVEDEEIECLVEIPTPQDYWG*
Isotype IgG2a, kappa
Applications Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot
Pack Size 100 µg
Physical Appearance Liquid
Presentation In 1x PBS; pH 7.2
Purity Immunoaffinity Chromatography 
Research Areas Extracellular Communication||Growth Factors Receptors
Solubility Soluble in water
Species Reactivity human
Specificity Antibody Reactive Against Recombinant Protein.
Storage and Handling Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Uniprot Number AAH38433
Usage Statement Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.