08P98809 MP BIOMEDICALS

Recombinant Human VEGF-D

from HEK293 cells

95%,

Measured by its ability to bind immobilized recombinant human Neuropilin-1 in an ELISA.

Synonyms Vascular Endothelial Growth Factor-D, FIGF, FAATFYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYSIIRR

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P988091 - 2 µgIn Stock $104.20
08P988092 - 10 µgIn Stock $289.45
08P988093 - 1 mg Call for Price -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from HEK293 cells
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters