08P98792 MP BIOMEDICALS

Recombinant Murine TRAIL

from E. Coli

95%, Assay#1:Determined by the dose-dependent stimulation of MIP-2 production by mouse spleen cells using a concentration range of 10-100 ng/mL.

Assay#2:Measured by its ability to induce apoptosis in LN-18 cells (human glioblastoma cells). The expected ED50 for this effect is 40.0-60.0 ng/mL.

Synonyms TNF-related apoptosis-inducing Ligand, TNFSF10, TL2, MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P987921 - 10 µgIn Stock $104.20
08P987922 - 50 µgIn Stock $289.45
08P987923 - 1 mgIn Stock $1,996.90
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters