08P98353 MP BIOMEDICALS

Recombinant Human BCA-1/BLC (CXCL13)

from E. Coli

98%, Determined by its ability to chemoattract human B cells using a concentration range of 1.0-10.0 ng/mL.

Synonyms B cell Attracting Chemokine-1, CXCL13, BLC (mouse), BLR1 Ligand, VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKRSSSTLPVPVFKRKIP

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P983531 - 5 µgDiscontinued-Inquire -
08P983532 - 20 µgDiscontinued-Inquire -
08P983533 - 1 mgDiscontinued-Inquire -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters