Antibodies

321 Results Found

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Peroxidase-Conjugated Rabbit IgG Fraction To Bovine Albumin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated rabbit IgG fraction to bovine albumin and buffer salts.

Rabbit Antiserum To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit antiserum to bovine IgG (whole molecule) and buffer salts. The antiserum is prepared by hyperimmunizing rabbits with highly purified bovine IgG; antiserum is delipidated and made specific by solid-phase absorption.

Rabbit IgG Fraction To Bovine IgG (Whole Molecule)

Product is the lyophilized powder of rabbit IgG fraction to bovine IgG (whole molecule) and buffer salts

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Fluorescein-Conjugated Goat Affinity Purified Antibody To Cat IgG (Whole Molecule)

Product is fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat affinity purified antibody to cat IgG (whole molecule) and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Cat IgG (Whole Molecule)

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to cat IgG (whole molecule) and buffer salts

Peroxidase-Conjugated Goat IgG Fraction To Cat IgG (Whole Molecule)

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to cat IgG (whole molecule) and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts

Rabbit Antiserum To Chicken Serum Albumin

Product is the lyophilized powder of rabbit antiserum to chicken serum albumin and buffer salts.

Goat IgG Fraction To Chicken Egg Albumin

Product is the lyophilized powder of goat IgG fraction to chicken egg albumin and buffer salts.

Rabbit IgG Fraction To Chicken Red Blood Cells

Product is the lyophilized powder of rabbit IgG fraction to chicken red blood cells and buffer salts.

Goat Antiserum To Chicken Serum (Forensic)

Product is the lyophilized powder of goat antiserum to chicken serum and buffer salts.