Primary Antibodies, Unconjugated

110 Results Found

Mouse IgG2b (Myeloma) Protein

Liquid with 1.0 mg of protein in 0.02 M Tris, 0.15 M sodium chloride, pH 8.1. No preservative has been added

Rabbit Peroxidase Anti-Peroxidase (Pap)

Product is the lyophilized powder of rabbit peroxidase anti-peroxidase complexes (PAP) and buffer salts

Antigen Affinity Gel Rabbit IgG (Whole Molecule)

Product is rabbit IgG (whole molecule) covalently coupled to Sepharose-4B, and packed in a polystyrene chromatography column.

Rabbit Affinity Purified Antibody To Bovine Albumin

Product is rabbit affinity purified antibody to bovine albumin and buffer salts.

Monoclonal Mouse Anti-Chondroitin-4-Sulfate Antibody

Reacts with both mouse (fetal and adult) and human (fetal and adult) chondroitinase ABC digested cartilage proteoglycans. Chondroitin-4 sulfate disaccharides successfully inhibit the binding of monoclonal antibody to proteoglycans.

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts

Rabbit Antiserum To Chicken Serum Albumin

Product is the lyophilized powder of rabbit antiserum to chicken serum albumin and buffer salts.

Goat IgG Fraction To Chicken Egg Albumin

Product is the lyophilized powder of goat IgG fraction to chicken egg albumin and buffer salts.

Goat Antiserum To Chicken Serum (Forensic)

Product is the lyophilized powder of goat antiserum to chicken serum and buffer salts.

Goat Antiserum To Deer Serum (Forensic)

Product is the lyophilized powder of goat antiserum to deer serum and buffer salts

Anti-Desmin Ii Monoclonal From Mouse

Anti-Human
Clone:
D9
Isotype: mouse IgG1
Conc/Titer: 1:5-1:20
Applications: Immunoblotting; Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded tissue sections.
The antibody was prepared from human leyomyoma. The antibody is specific to 53 kDa desmin protein in immunoblotting and gives the same cell staining pattern as cat. no. 10570, polyclonal desmin antibody. No cross-reactivity with any other intermediate filament protein. It does cross-react with desmin of most mammals including mouse, rabbit and rat. It is supplied as clarified cell culture supernatant with 0.09% sodium azide.
Ref.: Muyen, G.N.P. van, et al., Lab. Invest., 57: 359-369 (1987).