Dino

Primary Antibodies, Polyclonal, Goat, Deer

Active filters:

  • Antibody Type:
    Polyclonal
  • Host:
    Goat
  • Species Reactivity:
    Deer
  • Clear All

Rabbit Affinity Purified Antibody To Bovine Albumin

Product is rabbit affinity purified antibody to bovine albumin and buffer salts.

Monoclonal Mouse Anti-Chondroitin-4-Sulfate Antibody

Reacts with both mouse (fetal and adult) and human (fetal and adult) chondroitinase ABC digested cartilage proteoglycans. Chondroitin-4 sulfate disaccharides successfully inhibit the binding of monoclonal antibody to proteoglycans.

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Peroxidase-Conjugated Rabbit IgG Fraction To Bovine Albumin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated rabbit IgG fraction to bovine albumin and buffer salts.

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts

Rabbit Antiserum To Chicken Serum Albumin

Product is the lyophilized powder of rabbit antiserum to chicken serum albumin and buffer salts.

Goat IgG Fraction To Chicken Egg Albumin

Product is the lyophilized powder of goat IgG fraction to chicken egg albumin and buffer salts.

Goat Antiserum To Chicken Serum (Forensic)

Product is the lyophilized powder of goat antiserum to chicken serum and buffer salts.

Goat Antiserum To Deer Serum (Forensic)

Product is the lyophilized powder of goat antiserum to deer serum and buffer salts

Anti-Desmin Ii Monoclonal From Mouse

Anti-Human
Clone:
D9
Isotype: mouse IgG1
Conc/Titer: 1:5-1:20
Applications: Immunoblotting; Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded tissue sections.
The antibody was prepared from human leyomyoma. The antibody is specific to 53 kDa desmin protein in immunoblotting and gives the same cell staining pattern as cat. no. 10570, polyclonal desmin antibody. No cross-reactivity with any other intermediate filament protein. It does cross-react with desmin of most mammals including mouse, rabbit and rat. It is supplied as clarified cell culture supernatant with 0.09% sodium azide.
Ref.: Muyen, G.N.P. van, et al., Lab. Invest., 57: 359-369 (1987).

Mouse Anti-Desmoplakin 1 & 2, Monoclonal

The anti-desmoplakin 1 & 2 is a mouse IgG1 immunoglobulin. It is purified by affinity chromatography. The antigen is bovine desmoplakins 1 & 2.

Rabbit Antiserum To Dog Albumin

Product is the lyophilized powder of rabbit antiserum to dog albumin and buffer salts.

Goat Antiserum To Dog Complement C3

Product is the lyophilized powder of goat antiserum to dog complement C3.

Goat Antiserum To Dog Serum

Product is the lyophilized powder of goat antiserum to dog serum and buffer salts.

Rabbit Antiserum To Dog Serum (Forensic)

Product is the lyophilized powder of rabbit antiserum to dog serum and buffer salts.

Monoclonal Anti-Epithelial Keratin - AE1/AE3 Mixture

Anti-Human
Clone:
AE1/AE3 mixture
Isotype: purified Ig fraction from ascites
Conc/Titer: 1:100-1:200
Applications: Immunohistochemistry; Immunoblotting
This is a specially formulated mix that is broadly reactive with most acidic (Type 1) keratins and all known basic (Type 2) keratins. It exhibits cross-reactivity to human, rabbit, mouse, rat, bovine, and chick. This mix can be used for the positive identification of normal and abnormal epithelial cells and tissues. It works well on unfixed frozen sections and alcohol or formalin fixed, paraffin sections.

Monoclonal Mouse Anti-Epithelial Keratin - AE5

Monoclonal Mouse Anti-Epithelial Keratin antibody is specific for the basic 64K keratin which, together with the acidic 55K keratin, has been designated as a marker for "corneal-type differentiation".

Monoclonal Mouse Anti-Epithelial Keratin (AE8)

Anti-Human
Clone:
AE8
Isotype: purified Ig fraction from ascites
Conc/Titer: 1:50-1:500
Form: Liquid, purified IgG fraction from ascites fluid.
Applications: Immunoblotting; Indirect Immunofluorescence; Tissue sections
This antibody reacts strongly with the acidic 51 kDa (number 13) keratin which is expressed mainly in the suprabasal cells of esophageal, ventral tongue, buccal mucosal, exocervical and many other internal, non-keratinized stratified squamous epithelia. It can be used as markers for "esophageal-type differentiation."

H00051024-M01-3-36-1-L.jpg

FIS1 Monoclonal Antibody (M01), Clone 1G9

Mouse monoclonal antibody raised against a full length recombinant FIS1.

Anti-α-Fodrin (Nonerythroid Spectrin) Monoclonal (Clone AA6)

Anti-Human
Clone:
AA6
Isotype: affinity purified mouse IgG1
Conc/Titer: 0.1 μg/ml
Applications: Immunohistochemistry, Western Blotting, and additional Immunoassays.
The original immunogen was chicken blood cell membranes which were purified by hypotonic lysis and mechanical enucleation. The AA6 antibody is specific to the 240 kDa alpha-fodrin molecule of all mammalian non-erythroid cells and to chicken alpha-spectrin.

Goat IgG Fraction To ß-Galactosidase (No Cross To E. coli)

Product is goat IgG fraction to ß-galactosidase (no cross to E. coli) and buffer salts.

Mouse, Anti-Beta-Galactosidase, Purified Monoclonal Antibody

Anti-Galactosidase, purified monoclonal antibody [subclass IgG2a(k)] was purified from ascites of a mouse hybridoma and recognizes E. coli β-galactosidase. Recognizes the native and denatured enzyme near the C-terminal end.

Antibody Affinity Gel Purified Rabbit Antibody To ß-Galactosidase (No Cross To E. coli)

Product is rabbit IgG fraction to ß-galactosidase (no cross to E. coli) covalently coupled to 2ml of Sepharose-4B\, and packed in a polystyrene chromatography column.

Mouse, Anti-GFP, Monoclonal Antibody, With Bsa

Anti-GFP, Clone 3E6, is a mouse IgG2a monoclonal antibody (mAb) that recognizes the native form of the Green Fluorescent Protein (GFP), GFP variants and GFP-fusion proteins.

Rabbit Anti-Goat Serum

Anti-Goat Serum was produced in rabbit, and was used as control in protein characterization of serum albumin. The product is in lyophilized powder

Rabbit, Anti-Hemagglutinin, Affinity Pure

Rabbit, Affinity Purified, Polyclonal
Form: affinity purified liquid
Purification: Immunoaffinity purified using the peptide conjugated to a solid-phase support.
Applications: ELISA at 1:90,000; Western blot at 1:5000.

Rabbit, Anti-Hemocyanin, Keyhole Limpet (Klh) Affinity Pure

The antiserum is developed in rabbit using highly purified KLH as the immunogen. The antibody is purified from the rabbit antiserum using a KLH immunoabsorbant.

Goat Antiserum To Horse Serum

Product is the lyophilized powder of goat antiserum to horse serum and buffer salts

Goat Antiserum To Horse Serum (Forensic)

Product is the lyophilized powder of goat antiserum to horse serum and buffer salts.

Rabbit Anti-Horse Serum

Rabbits were immunized with pooled normal horse serum in Freund's adjuvant.

Rabbit Anti-Alpha Fetoprotein (Afp) Polyclonal

Liquid. The antibody is the purified immunoglobulin fraction of rabbit antiserum. It is supplied in 0.1 M sodium chloride

Goat Antiserum To Human Albumin

Anti-Human
Host:
goat
Form: lyophilized
Applications: Immunoblotting.

Goat IgG Fraction To Human Albumin

Product is the lyophilized powder of goat IgG fraction to human albumin and buffer salts.

Rabbit Antiserum To Human Albumin

Product is a lyophilized powder rabbit antiserum to human albumin and buffer salts.

Rabbit IgG Fraction To Human Albumin

Product is the lyophilized powder of rabbit IgG fraction to human albumin and buffer salts.

Goat Antiserum To Human Alpha-1-Antitrypsin

Product is the lyophilized powder of goat antiserum to human alpha-1-antitrypsin and buffer salts.

Goat IgG Fraction To Human Alpha-1-Antitrypsin

Product is the lyophilized powder of goat IgG fraction to human alpha-1-antitrypsin and buffer salts.

Rabbit Anti-Human Collagen Type IV Polyclonal

Anti-Human
Host:
rabbit
Form: liquid antiserum
Conc/Titer: 1:50-1:100
Applications: ELISA; Tissue sections
The antiserum was produced by repeated injections of collagen type IV from human placenta. It can be used on both acetone-fixed frozen sections and on proteolytically treated formalin-fixed sections. It is exclusively reactive with basement membranes in immunohistochemistry. It demonstrates slight cross-reactivity with collagen V in ELISA, and it reacts with various reduced and non-reduced human collagen type IV bands in immunobotting. The antibody does react with basement membranes of all mammals.

Goat Antiserum To Human Complement C9

Goat Antiserum To Human Complement C9

Goat IgG Fraction To Human Complement C3

Product is the lyophilized powder of goat IgG fraction to human complement C3 and buffer salts.

Goat IgG Fraction To Human Complement C4

Product is the lyophilized powder of goat IgG fraction to human complement C4 and buffer salts.

Rabbit Anti-Human Ferritin

Rabbit Anti-Human Ferritin is produced in rabbit using as immunogen ferritin isolated from normal human spleen.

Rabbit Antiserum To Human Hemoglobin

Rabbit antiserum to human hemoglobin is the lyophilized powder of rabbit antiserum to human hemoglobin and buffer salts.

Purified Mouse Monoclonal Antibody (HIV.Ot 39B) To Human Immunodeficiency Virus

The product is 100 µg of purified murine monoclonal antibody (IgG1) to HIV-1 p24 (214-226) in lyophilization medium, consisting of 10 mM Tris-HCl, pH 7.4, with 15% sucrose.

Human Luteinizing Hormone-Releasing Hormone (Lh-Rh) Polyclonal Antibody From Rabbit

(Anti-LH-RH)
Anti-Human
Host:
rabbit
Form: liquid
Applications: Immunoblotting; Immunostaining of acetone-fixed frozen and formalin-fixed, paraffin-embedded tissue sections.
This antiserum reacts against LH-RH which is produced in the hypothalamus and influences the release of luteinizing hormone in the pituitary gland. The antiserum is supplied with 1% ovalbumin and 0.09% sodium azide.

Monoclonal Anti-Human B-Lymphocyte LN-3

LN-3 is a murine monoclonal antibody (IgG2b) reactive with a nonpolymorphic HLA-DR (Ia-like) antigen. The antigens show the typical 29-33 K dalton molecular weight of Ia. The HLA-DR antigen is present on germinal center and mantle zone B cells, monocytes and macrophages and interdigitating histiocytes. T cells are generally negative although activated T cells may express HLA-DR.

Goat Anti-Human Properdin

Goat Anti-Human Properdin, in Liquid. This product contains 0.1% sodium azide as a preservative. Antiserum to human properdin is produced in goats following the injection of human properdin. Properdin was isolated from human plasma and purified by chromatographic techniques. The antiserum is an IgG fraction of the goat serum.

Anti-Prostatic Specific Antigen (PSA) Monoclonal ( Clone ER-PR8)

Anti-Human
Clone:
ER-PR8
Isotype: mouse IgG1 presented as ascites fluid
Conc/Titer: 1:10-1:20
Applications: Immunoblotting; Immunohistochemistry.
The original immunogen was from human prostate. The antibody reacts with a 34 kDa protein. Immunohistochemical studies have shown that the presence of PSA is highly specific for the demonstration of the prostatic origin of a malignancy. Antibodies to PSA have been shown to be valuable reagents for the positive identification of primary and metastatic prostatic carcinoma. This antibody reacts with both frozen and formalin-fixed paraffin embedded tissues.

Goat Anti-Human Prothrombin

Antiserum to human prothrombin is prepared in goat from immunogens isolated from human plasma. The antiserum is the globulin fraction obtained by precipitation with ammonium sulfate.

Rabbit Antiserum To Human Red Blood Cells

Anti-Human
Host:
rabbit
Form: lyophilized
Applications: Immunoblotting; Immunostaining of acetone-fixed frozen and formalin-fixed, paraffin-embedded tissue sections.

Rabbit Antiserum To Human Seminal Fluid (Absorbed)

Product is the lyophilized powder of rabbit antiserum to human seminal fluid (absorbed against human serum) and buffer salts.

Goat Antiserum To Human Serum

Product is the lyophilized powder of goat antiserum to human serum and buffer salts. It is used in Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded tissue sections.

Goat Antiserum To Human Serum (Forensic)

Product is the lyophilized powder of goat antiserum to human serum and buffer salts.

Rabbit Antiserum To Human Serum

Rabbit Antiserum to Human Serum is the lyophilized powder of rabbit antiserum to human serum and buffer salts.

Goat Antiserum To Human Transferrin

Product is the lyophilized powder of goat antiserum to human transferrin and buffer salts.

Goat Antiserum To Human Uromucoid

Product is the lyophilized powder of goat antiserum to human uromucoid (Tamm-Horsfall glycoprotein) and buffer salts.

Vimentin, Anti-Human Goat Lq

Product is the lyophilized powder of goat antiserum to human uromucoid (Tamm-Horsfall glycoprotein) and buffer salts.

H00338376-M01-9-20-1.jpg

IFNE1 Monoclonal Antibody (M01), Clone 3B8

Mouse monoclonal antibody raised against a partial recombinant IFNE1.

Goat Antiserum To Mouse Complement C3

Product is the lyophilized powder of goat antiserum to mouse complement C3 and buffer salts.

Goat F(Ab')2 Fragment To Mouse Complement C3

Product is the lyophilized powder of goat F(ab')2 fragment to mouse complement C3 and buffer salts.

Goat IgG Fraction To Mouse Complement C3

Product is the lyophilized powder of goat IgG fraction to mouse complement C3 and buffer salts.

Rabbit Antiserum To Mouse Hemoglobin

Product is the lyophilized powder of rabbit antiserum to mouse hemoglobin and buffer salts.

Goat Antiserum To Mouse Serum

Product is the lyophilized powder of goat antiserum to mouse serum and buffer salts

Goat Antiserum To Mouse Serum (Forensic)

Product is the lyophilized powder of goat antiserum to mouse serum and buffer salts.

Goat Antiserum To Mouse Transferrin

Product is the lyophilized powder of goat antiserum to mouse transferrin and buffer salts.

Mouse Anti-Neurofilament 200 Monoclonal (Clone NE14)

The immunogen used to produce this monoclonal antibody is neurofilament purified from human brain. The isotype is mouse IgG1. This product is a monoclonal antibody to the neurofilament peptide of apparent molecular weight of 200,000.

H00004987-M02-9-18-1.jpg

Oprl1 Monoclonal Antibody (M02), Clone 2A11

Mouse monoclonal antibody raised against a partial recombinant OPRL1.

Mouse Anti-Phosphotyrosine, (Clone PY20)

Antibody is packaged in quantities of 100 µg at a concentration of 1 mg/ml in 20 mM sodium phosphate, 150 mM sodium chloride, pH 7.5. It is a highly purified immunoglobulin fraction.

Anti-Glucagon Polyclonal From Rabbit

Glucagon is a hormone that is secreted by α cells in the pancreas. Glucagon antagonizes insulin by converting glycogen to glucose in the liver and increasing blood sugar levels. Glucagon-like peptide 1 (GLP1), Glucagon-like peptide 2 (GLP2), VIP (vasoactive intestinal peptide) and PACAP (pituitary adenylate cyclase activating polypeptide) are in the glucagon's hormone family. GLP1 is a transmitter in the central nervous system that regulates feeding and drinking behavior. GLP2 stimulates intestinal epithelial growth.

Rabbit Anti-Porcine Serum

Rabbit Anti-Porcine Serum

Goat Antiserum To Rabbit Serum

Product is the lyophilized powder of goat antiserum to rabbit serum and buffer salts

Goat Antiserum To Rabbit Serum (Forensic)

Product is the lyophilized powder of goat antiserum to rabbit serum and buffer salts.

Goat Antiserum To Rat Albumin

Product is the lyophilized powder of goat antiserum to rat albumin and buffer salts.

Rabbit Antiserum To Rat Albumin

Rabbit antiserum to rat albumin is the lyophilized powder of rabbit antiserum to rat albumin and buffer salts.

Sheep IgG Fraction To Rat Albumin

Product is the lyophilized powder of sheep IgG fraction to rat albumin and buffer salts.

Peroxidase-Conjugated Sheep IgG Fraction To Rat Albumin

Peroxidase-conjugated sheep IgG fraction to rat albumin is the lyophilized powder of horseradish peroxidase (HRP)-conjugated sheep IgG fraction to rat albumin and buffer salts. IgGs are glycoprotein antibodies that modulate several immune responses. Rat IgGs against target proteins are often used as primary antibodies in various research applications. Thus, secondary anti-rat IgG conjugated to a detectable substrate is a useful tool for the analysis of target proteins. Anti-Rat IgG (whole molecule)-Peroxidase antibody binds all rat immunoglobulins.

Goat Antiserum To Rat Complement C3

Product is the lyophilized powder of goat antiserum to rat complement C3 and buffer salts.

Goat IgG Fraction To Rat Complement C3

Goat IgG Fraction To Rat Complement C3 is the lyophilized powder of goat IgG fraction to rat complement C3 and buffer salts.

Goat Antiserum To Rat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to rat serum and buffer salts.

Rabbit IgG Fraction To Rat Transferrin

Product is the lyophilized powder of rabbit IgG fraction to rat transferrin and buffer salts.

Dog Anti-Sheep Red Blood Cells

Anti-Sheep
Host:
dog
Form: lyophilized antiserum
Applications: Positive Coombs' Test Control
Because anti-globulin positive canine red blood cells are unstable, MP offers dog antiserum to sheep red blood cells. This reagent may be used to sensitize fresh sheep red blood cells for use as a positive control. It may also be used to prepare red blood cells for the canine Rose-Waller procedure.

Rabbit Antiserum To Sheep Red Blood Cells

Rabbit polyclonal to Sheep Red Blood Cell Stroma.

Rabbit IgG Fraction To Sheep Red Blood Cells

Product is the lyophilized powder of rabbit IgG fraction to sheep red blood cells and buffer salts.

Goat Antiserum To Sheep Serum (Forensic)

Product is the lyophilized powder of goat antiserum to sheep serum and buffer salts.

Rabbit Anti-Sheep Serum

Anti-Sheep
Host:
rabbit
Form: lyophilized powder

SIAH2 Monoclonal Antibody (M01), Clone 1F5

Mouse monoclonal antibody raised against a partial recombinant SIAH2.

Rabbit Anti-Somatostatin

The antigen used in the production of this antiserum is synthetic somatostatin bound to bovine thyroglobulin. The antiserum has been raised in New Zealand white rabbits by the repeated injections of the antigen emulsified in Freund's Complete Adjuvant. Serum from the appropriate bleeds was collected and lyophilized. The product is an unfractionated whole serum and contains 0.1% sodium azide

Goat Antiserum To Swine Serum

Product is the lyophilized powder of goat antiserum to swine serum and buffer salts. The antiserum is prepared by hyperimmunizing goats with swine serum.

Goat Antiserum To Swine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to swine serum and buffer salts.

Mouse Anti-Synaptophysin IgG1 Monoclonal (Clone: SY38)

The immunogen used to make this antibody is synaptophysin from presynaptic vesicles prepared from bovine brain. The mouse monoclonal antibody is then purified by Protein A affinity chromatography.

Anti-Synaptophysin Polyclonal From Rabbit

Synaptophysin is a calcium-binding and integral membrane glycoprotein present in presynaptic vesicles in almost all neurons. Synaptophysin has four transmembrane domains and it forms a complex with dynamin at high calcium concentrations suggesting an involvement in synaptic vesicle endocytosis.Synaptophysin is currently the most widely used marker for nerve terminals and for differentiating neuroendocrine tumors.

Rabbit Anti-Toxoplasma Gondii

This antibody is designed for specific and qualitative detection of Toxoplasma gondii in infected tissues. Formalin-fixed paraffin-embedded and frozen tissue sections can be used. Characterization of this antibody by immunohistochemistry has shown specific staining for Toxoplasma organisms in infected brain tissue.

TRNT1 Monoclonal Antibody (M01), Clone 1G11

Mouse monoclonal antibody raised against a full-length recombinant TRNT1.

Vimentin Monoclonal Antibody From Mouse

Anti-Bovine
Clone:
V9
Conc/Titer: 1:50-1:200
Isotype: mouse IgG1
Applications: Immunoblotting; Immunostaining of cell suspensions, acetone-fixed frozen tissue sections, and formalin-fixed, paraffin-embedded (microwaved) tissue sections.
The original antigen was purified calf lens. The antibody reacts specifically to 57 kDa vimentin protein in immunoblotting. Additionally, it reacts specifically with cells of mesenchymal origin including fibroblasts, endothelial cells, smooth muscle cells, chondrocytes, lymphocytes and blood cells. It cross-reacts with vimentin of most mammals including human, mouse, rat and rabbit. It is supplied as clarified cell culture supernatant with 1% BSA and 0.09% sodium azide.
Ref.: Van Muijen, G.N., et al., Lab. Invest., 57(4): 359-369, (1987).

Anti-Vinculin (Clone FB11), Monoclonal

Anti-Human
Clone:
FB11
Isotype: mouse IgG1
Applications: Immunohistochemistry, Immunoblotting.

VNN3 Monoclonal Antibody (M01), Clone 3E1

Mouse monoclonal antibody raised against a partial recombinant VNN3.

Fluorescein-Conjugated Goat IgG Fraction To ß-Galactosidase(No Cross To E. coli)

Product is fluorescein-5-isothiocyanate (FITC "Isomer I") - comjugated goat IgG fraction to ß-galactosidase (no cross to E. coli) and buffer salts

Fluorescein-Conjugated Rabbit IgG Fraction To ß-Galactosidase(No Cross To E. coli)

Product is fluorescein-5-isothiocyanate (FITC "Isomer I") - comjugated rabbit IgG fraction to ß-galactosidase (no cross to E. coli) and buffer salts.

Fluorescein-Conjugated Goat F(Ab')2 Fragment To Human Complement C3

Fluorescein-Conjugated Goat F(ab')2 Fragment to Human Complement C3 is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat F(ab')2 fragment to human complement C3 and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Human Complement C4

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to human complement C4 and buffer salts.

Fluorescein-Conjugated Goat F(Ab')2 Fragment To Mouse Complement C3

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat F(ab')2 fragment to mouse complement C3 and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Mouse Complement C3

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to mouse complement C3 and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Guinea Pig Complement C3

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to guinea pig complement C3 and buffer salts.

Goat F(Ab')2 Fragment To Rabbit Complement C3, FITC Conjugated

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to rabbit complement C3 and buffer salts.

Fluorescein-Conjugated Goat IgG Fraction To Rat Complement C3

Product is the lyophilized powder of fluorescein-5-isothiocyanate (FITC "Isomer I")-conjugated goat IgG fraction to rat complement C3 and buffer salts

Goat Antiserum To Bear Serum

Product is the lyophilized powder of goat antiserum to bear serum and buffer salts.

Peroxidase-Conjugated Goat IgG Fraction To Human Albumin

Anti-Human
Host:
goat
Form: lyophilized
Applications: Immunoblotting.
This is an anti-human albumin goat IgG isotype antibody.
HRP Conjugated

Peroxidase-Conjugated Goat IgG Fraction To Human Alpha-1-Antitrypsin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to human alpha-1-antitrypsin and buffer salts.

Peroxidase-Conjugated Goat IgG Fraction To Human Complement C3

Peroxidase-Conjugated Goat IgG Fraction To Human Complement C3 is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to human complement C3 and buffer salts.

Peroxidase-Conjugated Goat IgG Fraction To Human Fibrinogen

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to human fibrinogen and buffer salts.

Peroxidase-Conjugated Goat IgG Fraction To Human Fibronectin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to human fibronectin and buffer salts.

Peroxidase-Conjugated Goat IgG Fraction To Mouse Complement C3

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated goat IgG fraction to mouse complement C3 and buffer salts.

Peroxidase-Conjugated Rabbit IgG Fraction To Rat Albumin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated rabbit IgG fraction to rat albumin and buffer salts.

Mouse IgG2b (Myeloma) Protein

Liquid with 1.0 mg of protein in 0.02 M Tris, 0.15 M sodium chloride, pH 8.1. No preservative has been added

Rabbit Peroxidase Anti-Peroxidase (Pap)

Product is the lyophilized powder of rabbit peroxidase anti-peroxidase complexes (PAP) and buffer salts

Antigen Affinity Gel Rabbit IgG (Whole Molecule)

Product is rabbit IgG (whole molecule) covalently coupled to Sepharose-4B, and packed in a polystyrene chromatography column.

Rabbit IgG Fraction To Human Red Blood Cells

Anti-Human
Host:
rabbit
Form: lyophilized (IgG)
Applications: Immunoblotting; Immunostaining of acetone-fixed frozen and formalin-fixed, paraffin-embedded tissue sections.

Anti-Human Collagen Type II, Mouse (Clone II-4CII), Purified IgG

Anti-human Type II collagen antibody was raised in mice after immunization with collagen Type II from human costal cartilage.

Mouse Anti-Actin, Monoclonal (Clone C4)

The monoclonal actin (clone C4) is a mouse IgG1 (gamma 1 heavy/kappa light chain) antibody. The monoclonal actin (clone C4) is a mouse IgG1 (gamma 1 heavy/kappa light chain) antibody. Chicken gizzard actin was used as the immunogen. Immunoblots demonstrate specificity directed towards all actins ranging from yeast, to flies, to mouse, to man. These are skeletal alpha-actin, cardiac alpha-actin, smooth muscle gamma actin, cytoplasmic beta-actin, cytoplasmic gamma actin as well as Dictyostelium discoideum and Physarum olycephalum actins. The epitope for the antibody lies between residues 18-40, a highly conserved region of the molecule. This antibody can also be used for cells cultivated on slides, for frozen tissue sections and as a loading control for western blots.

Mouse Anti-Glial Fibrillary Acidic Protein (GFAP) Monoclonal

Product is a mouse monoclonal antibody, isotype IgG1, that reacts with Glial Fibrillary Acidic Protein.