Primary Antibodies

129 Results Found

Rabbit IgG Fraction To Human Red Blood Cells

Anti-Human
Host:
rabbit
Form: lyophilized (IgG)
Applications: Immunoblotting; Immunostaining of acetone-fixed frozen and formalin-fixed, paraffin-embedded tissue sections.

Anti-Human Collagen Type II, Mouse (Clone II-4CII), Purified IgG

Anti-human Type II collagen antibody was raised in mice after immunization with collagen Type II from human costal cartilage.

Mouse Anti-Actin, Monoclonal (Clone C4)

The monoclonal actin (clone C4) is a mouse IgG1 (gamma 1 heavy/kappa light chain) antibody. The monoclonal actin (clone C4) is a mouse IgG1 (gamma 1 heavy/kappa light chain) antibody. Chicken gizzard actin was used as the immunogen. Immunoblots demonstrate specificity directed towards all actins ranging from yeast, to flies, to mouse, to man. These are skeletal alpha-actin, cardiac alpha-actin, smooth muscle gamma actin, cytoplasmic beta-actin, cytoplasmic gamma actin as well as Dictyostelium discoideum and Physarum olycephalum actins. The epitope for the antibody lies between residues 18-40, a highly conserved region of the molecule. This antibody can also be used for cells cultivated on slides, for frozen tissue sections and as a loading control for western blots.

Mouse Anti-Glial Fibrillary Acidic Protein (GFAP) Monoclonal

Product is a mouse monoclonal antibody, isotype IgG1, that reacts with Glial Fibrillary Acidic Protein.

Rabbit Affinity Purified Antibody To Bovine Albumin

Product is rabbit affinity purified antibody to bovine albumin and buffer salts.

Monoclonal Mouse Anti-Chondroitin-4-Sulfate Antibody

Reacts with both mouse (fetal and adult) and human (fetal and adult) chondroitinase ABC digested cartilage proteoglycans. Chondroitin-4 sulfate disaccharides successfully inhibit the binding of monoclonal antibody to proteoglycans.

Monoclonal Mouse Anti-Chondroitin-6-Sulfate Antibody

Reacts with a wide range of cartilage proteoglycans after either chondroitinase (ABC or AC) or testicular hyaluronidase digestion.

Monoclonal Anti-Alpha-Smooth Muscle Actin (Mouse Ascites Fluid), Clone 1A4

Anti-α-Smooth Muscle Actin
Clone: 1A4
Isotype: mouse IgG2a ascites
Conc/Titer: 1:400
Applications: Indirect Immunofluorescence.
The original immunogen was the NH2 terminal synthetic decapeptide of α smooth muscle actin coupled to KLH. It is specific for the single isoform α smooth muscle actin. In the original publication describing this antibody it was named anti-alpha-sm-1.

Mouse Anti-Actin Mab Clone B4

The monoclonal actin (clone B4) antibody is a mouse IgG1, kappa light chain antibody. Chicken gizzard was used as the immunogen. Immunoblots demonstrate specificity directed towards the smooth muscle gamma-enteric isoform of actin. This antibody can be used to detect the other smooth muscle actin (alpha-skeletal, alpha-cardiac and alpha-vascular) found in vertebrates.

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Rabbit Anti-Bovine Serum Albumin

Product is the lyophilized powder of anti-bovine serum albumin from rabbit IgG fraction with buffer salts.

Peroxidase-Conjugated Rabbit IgG Fraction To Bovine Albumin

Product is the lyophilized powder of horseradish peroxidase (HRP)-conjugated rabbit IgG fraction to bovine albumin and buffer salts.

Goat Antiserum To Bovine Serum (Forensic)

Product is the lyophilized powder of goat antiserum to bovine serum and buffer salts.

0865850-anti-thyroxine-serum-rabbit-anti-t4.jpg

Rabbit Anti-Thyroxine BSA Serum

Product is lyophilized. Reconstitute with 1.0 ml of distilled water and let stand for 30 minutes at room temperature.

Rabbit Antiserum To Bovine Transferrin

Product is the lyophilized powder of rabbit antiserum to bovine transferrin and buffer salts.

Goat Antiserum To Cat Serum (Forensic)

Product is the lyophilized powder of goat antiserum to cat serum and buffer salts

Rabbit Antiserum To Chicken Serum Albumin

Product is the lyophilized powder of rabbit antiserum to chicken serum albumin and buffer salts.

Goat IgG Fraction To Chicken Egg Albumin

Product is the lyophilized powder of goat IgG fraction to chicken egg albumin and buffer salts.

Goat Antiserum To Chicken Serum (Forensic)

Product is the lyophilized powder of goat antiserum to chicken serum and buffer salts.