Cart
 
Inquire

Anti-ARID1A mouse monoclonal antibody (M02), Clone 3H14, 100 µg

Anti-ARID1A mouse monoclonal antibody (M02), Clone 3H14, 100 µg

Mouse monoclonal antibody raised against a partial recombinant human ARID1A.

SKU: 08A0082891

Packaging size:
100 µg
Product Description

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Usage Statement

Unless specified otherwise, MP Biomedical's products are for research or further manufacturing use only, not for direct human use. For more information, please contact our customer service department.

Specifications
SKU 08A0082891
Antibody Type Monoclonal Antibody
Base Catalog Number A0082891
Clone Name 3H14
Conjugate Unconjugated
Formulation Details Purified
Host Mouse
Isotype IgG2a, kappa
Pack Size 100 µg
Purity Affinity Purified
Solubility Soluble in water
Usage Statement Unless specified otherwise, MP Biomedical's products are for research or further manufacturing use only, not for direct human use. For more information, please contact our customer service department.
Documents

Certificates of Analysis

Certificates of Analysis
English (United States)
Certificates of Analysis
English (United States)
Certificates of Analysis
English (United States)

Material Safety Data Sheet

Material Safety Data Sheet
English (United States)