Anti-human IFNE1, monoclonal antibody (M01), Clone 3B8, 100 µg

Anti-human IFNE1, monoclonal antibody (M01), Clone 3B8, 100 µg

Synonyms interferon, epsilon

Packaging size: 100 µg

SKU 08A338376
¥145,800.00
Inquire
Request a quote
Description

Product Description

Mouse monoclonal antibody raised against a partial recombinant IFNE1.

Usage Statement

Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Key Applications

Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot

Specifications
SKU 08A338376
Alternate Names interferon, epsilon
Antibody Category Monoclonal Antibodies
Antibody Research Category Other
Antibody Type Monoclonal Antibody
Base Catalog Number A338376
Clone Name 3B8
Concentration 0.5 mg/ml
Conjugate Unconjugated
Gene ID 338376
Gene Symbol and Aliases IFNE||IFN-E||IFNE1||IFNT1||MGC119018||MGC119020||PRO655
Host Mouse
Immunogen Human IFNE1 (NP_795372, 109 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence FLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR*
Isotype IgG2a, kappa
Pack Size 100 µg
Presentation In 1x PBS; pH 7.2
Purity Purified
Research Areas Cell Biology
Solubility Soluble in water
Specificity Antibody Reactive Against Recombinant Protein.
Storage and Handling Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Uniprot Number NP_795372
Usage Statement Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Applications Immunoassays, ELISA, Immunoblot, Flow Cytometry (FACS), Immunohistochemistry (Paraffin), Protein Purification
Species Reactivity Human