Anti-ARID1A mouse monoclonal antibody (M02), Clone 3H14, 100 µg
ARID1A monoclonal antibody (M02), clone 3H14
Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.
Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*
Reactivity: Human
Isotype: IgG Mix Kappa
Storage Buffer: In 1x PBS, pH 7.2
Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality Control Testing: Antibody Reactive Against Recombinant Protein.
Usage Statement
Unless specified otherwise, MP Biomedical's products are for research or further manufacturing use only, not for direct human use. For more information, please contact our customer service department.
SKU | 08A0082891 |
Antibody Type | Monoclonal Antibody |
Base Catalog Number | A0082891 |
Clone Name | 3H14 |
Conjugate | Unconjugated |
Formulation Details | Purified |
Host | Mouse |
Isotype | IgG2a, kappa |
Pack Size | 100 µg |
Purity | Affinity Purified |
Solubility | Soluble in water |
Usage Statement | Unless specified otherwise, MP Biomedical's products are for research or further manufacturing use only, not for direct human use. For more information, please contact our customer service department. |