VNN3 Monoclonal Antibody (M01), Clone 3E1

VNN3 Monoclonal Antibody (M01), Clone 3E1

Synonyms vanin 3

Packaging size: 100 µg

SKU 08A055350
Price:
$479.10
In Stock
Request a quote
Description

Product Description

Mouse monoclonal antibody raised against a partial recombinant VNN3.

Usage Statement

Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Key Applications

Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot

Specifications
SKU 08A055350
Alternate Names vanin 3
Antibody Category Monoclonal Antibodies
Antibody Research Category Other
Antibody Type Monoclonal Antibody
Clone Name 30
Conjugate Unconjugated
Formulation Purified
Gene ID 55350
Gene Symbol and Aliases VNN3||HSA238982||MGC171203||PAGEL-beta||PAGEL-eta||PAGEL-zeta
Host Mouse
Immunogen Human VNN3 (NP_060869, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence ARYHKYNLFAPEIQFDFPKDSELVTFDTPFGKFGIFTCFDIFSHDPAVVVVDEFQLTAFSTPQHGTTRCPSSRLFPSIQHGPRPWESIYLLQIPTTPACT*
Isotype IgG2b, kappa
Applications Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot
Pack Size 100 µg
Physical Appearance Liquid
Presentation In 1x PBS; pH 7.2
Purity Immunoaffinity Chromatography 
Research Areas Cell Biology
Solubility Soluble in water
Species Reactivity human
Specificity Antibody Reactive Against Recombinant Protein.
Storage and Handling Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Uniprot Number NP_060869
Usage Statement Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.