TRNT1 Monoclonal Antibody (M01), Clone 1G11

TRNT1 Monoclonal Antibody (M01), Clone 1G11

Synonyms tRNA nucleotidyl transferase, CCA-adding, 1

Packaging size: 100 µg

SKU 08A051095
Price:
$510.70
In Stock
Request a quote
Description

Product Description

Mouse monoclonal antibody raised against a full-length recombinant TRNT1.

Application Notes

Immunoassays, fluorescein immunoassays and blot, cell or tissue immunostaining

Usage Statement

Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Key Applications

Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot

Specifications
SKU 08A051095
Alternate Names tRNA nucleotidyl transferase, CCA-adding, 1
Antibody Category Monoclonal Antibodies
Antibody Research Category Other
Antibody Type Monoclonal Antibody
Application Notes Immunoassays, fluorescein immunoassays and blot, cell or tissue immunostaining
Clone Name 1G11
Concentration 1 mg/ml
Conjugate Unconjugated
Formulation Purified
Gene ID 51095
Gene Symbol and Aliases TRNT1||CCA1||CGI-47||MtCCA
Host Mouse
Immunogen Human TRNT1 (AAH12537, 1 a.a. ~ 406 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence MKLQSPEFQSLFTEGLKSLTELFVKENHELRIAGGAVRDLLNGVKPQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITTLRIDVTTDGRHAEVEFTTDWQKDAERRDLTINSMFLGFDGTLFDYFNGYEDLKNKKVRFVGHAKQRIQEDYLRILRYFRFYGRIVDKPGDHDPETLEAIAENAKGLAGISGERIWVELKKILVGNHVNHLIHLIYDLDVAPYIGLPANASLEEFDKVSKN
Isotype IgG2b, kappa
Applications Immunoassays | Protein Purification| Flow Cytometry (FACS) | ELISA | Immunohistochemistry (Paraffin) | Immunoblot
Pack Size 100 µg
Physical Appearance Liquid
Presentation In 1x PBS; pH 7.2
Purity Immunoaffinity Chromatography 
Research Areas Cell Biology
Solubility Soluble in water
Species Reactivity human
Specificity Antibody Reactive Against Recombinant Protein.
Storage and Handling Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Uniprot Number AAH12537
Usage Statement Research Use Only (RUO). Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.