Dino

ARID1A Monoclonal Antibody (M02), Clone 3H14

ARID1A Monoclonal Antibody (M02), Clone 3H14

Packaging size: 100 µg

SKU 08A0082891
Price:
$479.10
In Stock
Request a quote
Description

Product Description

ARID1A monoclonal antibody (M02), clone 3H14

Product Description: Mouse monoclonal antibody raised against a partial recombinant ARID1A.

Immunogen: ARID1A (NP_006006, 1216 a.a. ~ 1326 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence (without GST): NTSDMMGRMSYEPNKDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAG PGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPD SGMYSPSRYP*

Reactivity: Human

Isotype: IgG Mix Kappa

Storage Buffer: In 1x PBS, pH 7.2

Storage Instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

Quality Control Testing: Antibody Reactive Against Recombinant Protein.

Specifications
SKU 08A0082891
Antibody Type Monoclonal Antibody
Clone Name 3H14
Conjugate Unconjugated
Formulation Details Purified
Host Mouse
Isotype IgG2a, kappa
Pack Size 100 µg
Presentation Purified
Purity Affinity Purified
Solubility Soluble in water