08P98807 MP BIOMEDICALS

Recombinant Human VEGF-C

from HEK293 cells

95%,

Determined by its ability to support rat Retinal Ganglion Cells (RGC-5) cell growth in low serum media.

Synonyms Vascular Endothelial Growth Factor-C, VRP, flt4 ligand, MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P988071 - 5 µgIn Stock $99.25
08P988072 - 20 µgIn Stock $275.65
08P988073 - 1 mg Call for Price -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from HEK293 cells
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters