08P98780 MP BIOMEDICALS

Recombinant Human TIMP-1

from E. Coli

95%, TIMP1 activity was measured by its ability to inhibit human MMP-1 induced hydrolysis of a chromogenic peptide substrate at room temperature. Half maximal inhibition was obtained at a TIMP-1 concentration of approximately 0.5 μg/mL, when using an MMP-1 concentration of 1.6 μg/mL.

Synonyms Tissue inhibitor of metalloproteinases: Fibroblast collagenase inhibitor, Erythroid-potentiating activity, CTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P987801 - 2 µgIn Stock $99.25
08P987802 - 10 µgIn Stock $275.65
08P987803 - 1 mgIn Stock $6,615.00
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters