08P98714 MP BIOMEDICALS

Recombinant Murine RELMγ

from E. Coli

98%, Not available at this time.

Synonyms Resistin-like γ, EGTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P987141 - 5 µgIn Stock $99.25
08P987142 - 25 µgIn Stock $275.65
08P987143 - 1 mgIn Stock $3,858.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters