08P98679 MP BIOMEDICALS

Recombinant Human p16-INK4a

from E. Coli

95%, Data Not Available.

Synonyms Cyclin-dependent kinase inhibitor 2A, Cyclin-dependent kinase 4 inhibitor A, CDK4I, p16INK4A, p16-INK4, Multiple tumor suppressor 1, MTS-1, MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P986791 - 5 µgIn Stock $99.25
08P986792 - 20 µgIn Stock $275.65
08P986793 - 1 mgIn Stock $4,299.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters