08P98678 MP BIOMEDICALS

Recombinant Human sOX40 Ligand

from Hi-5 Insect cells

97%, Determined by its ability to stimulate IL-8 production by human PBMC using a concentration range of 30-100 ng/mL. Note: Results may vary with PBMC donors.

Synonyms TNFSF4, OX40L, Gp34, CD252, QVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P986781 - 2 µgIn Stock $99.25
08P986782 - 10 µgIn Stock $275.65
08P986783 - 1 mgIn Stock $6,615.00
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from Hi-5 Insect cells
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters