08P98628 MP BIOMEDICALS

Recombinant Human MIA

from E. Coli

98%, The ED50 was determined by the dose-dependant proliferation of the human A375 melanoma cell line. The expected ED50 for this effect is 4-6 μg/mL.

Synonyms Melanoma Inhibitory Activity, Cartilage-derived retinoic acid-sensitive protein (CD-RAP), MGPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P986281 - 5 µgIn Stock $99.25
08P986282 - 20 µgIn Stock $275.65
08P986283 - 1 mgIn Stock $4,299.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters