08P98608 MP BIOMEDICALS

Recombinant Murine Lungkine (CXCL15)

from E. Coli

98%, Determined by its ability to chemoattract human neutrophils using a concentration range of 20.0-100.0 ng/mL.

Synonyms CXCL15, QELRCLCIQEHSEFIPLKLIKNIMVIFETIYCNRKEVIAVPKNGSMICLDPDAPWVKATVGPITNRFLPEDLKQKEFPPAMKLLYSVEHEKPLYLSFGRPENKRIFPFPIRETSRHFADLAHNSDRNFLRDSSEVSLTGSDA

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P986081 - 5 µgIn Stock $99.25
08P986082 - 20 µgIn Stock $275.65
08P986083 - 1 mgIn Stock $3,858.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters