08P98586 MP BIOMEDICALS

Recombinant Rat IP-10 (CXCL10)

from E. Coli

98%, Determined by its ability to chemoattract hCXCR3/HEK293 cells using a concentration range of 10.0-50.0 ng/mL.

Synonyms γ-Interferon Inducible Protein 10, CXCL10, crg-2, IPLARTVRCTCIDFHEQPLRPRAIGKLEIIPASLSCPHVEIIATMKKNNEKRCLNPESEAIKSLLKAVSQRRSKRAP

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P985861 - 5 µgIn Stock $99.25
08P985862 - 25 µgIn Stock $275.65
08P985863 - 1 mgIn Stock $3,858.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters