08P98549 MP BIOMEDICALS

Recombinant Human IL-21

from E. Coli

98%, Assay #1:Determined by its ability to proliferate activated B cells.

Assay #2:Determined by its ability to induce human CD40L-activated na&iumL;ve B cells to undergo Ig isotype switching to IgG, using an IL-21 concentration of 50 ng/mL. Maximal activity was achieved after approximately five cell divisions.
Avery, D.T. et. al. (2008) J. Immunol. 181, 1767-1779.

Synonyms MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P985491 - 2 µgIn Stock $99.25
08P985492 - 10 µgIn Stock $275.65
08P985493 - 1 mgIn Stock $6,615.00
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters