08P98541 MP BIOMEDICALS

Recombinant Human IL-1Ra

from E. Coli

98%, Determined by its ability to inhibit the IL-1α stimulation of murine D10S cell. The expected ED50 is 20-40 ng/mL in the presence of 50 pg/mL of IL-1α.

Synonyms IL-1Ra, ICIL-1RA, IRAP, IL-1RN, MRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P985411 - 20 µgIn Stock $99.25
08P985412 - 100 µgIn Stock $275.65
08P985413 - 1 mgIn Stock $1,378.15
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters