08P98515 MP BIOMEDICALS

Recombinant Murine IL-11

from E. Coli

98%, The ED50 was determined by the dose-dependent stimulation of the proliferation of murine T11 cells is ≤ 2.0 ng/mL, corresponding to a specific activity of ≥ 5 x 105 units/mg.

Synonyms AGIF (Adipogenesis inhibitory factor), MPGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHSLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYLRHVQWLRRAGGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPVIPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P985151 - 2 µgIn Stock $99.25
08P985152 - 10 µgIn Stock $275.65
08P985153 - 1 mgIn Stock $6,615.00
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters