08P98506 MP BIOMEDICALS

Recombinant Human IGF-BP6

from (BTI-Tn-5B1-4) Hi-5 Insect cells*

95%, Determined by its ability to inhibit IGF-II induced proliferation of human MCF-7 cells. The expected ED50 for this effect is 0.1 – 0.4 μg/mL.

Synonyms IBP-6, RCPGCGQGVQAGCPGGCVEEEDGGSPAEGCAEAEGCLRREGQECGVYTPNCAPGLQCHPPKDDEAPLRALLLGRGRCLPARAPAVAEENPKESKPQAGTARPQDVNRRDQQRNPGTSTTPSQPNSAGVQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGKSLPGSPDGNGSSSCPTGSSG

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P985061 - 5 µgIn Stock $99.25
08P985062 - 20 µgIn Stock $275.65
08P985063 - 1 mg Call for Price -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from (BTI-Tn-5B1-4) Hi-5 Insect cells*
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters