08P98490 MP BIOMEDICALS

Recombinant Human HVEM-Fc

from Hi-5 Insect cells

98%, Determined by its ability to neutralize 0.25 ng/mL of hTNFβ induced cytotoxicity on murine L929 cells. The expected ED50 for this effect is 1.3-1.9 μg/mL of HVEM-Fc.

Synonyms HVEM, TNFSFR14, ATAR, TR2, LPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKRSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P984901 - 20 µgIn Stock $99.25
08P984902 - 100 µgIn Stock $275.65
08P984903 - 1 mgIn Stock $1,378.15
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from Hi-5 Insect cells
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters