08P98465 MP BIOMEDICALS

Recombinant Rat GDNF

from E. Coli

98%, Determined by its ability to stimulate the proliferation of rat C6 cells.

Synonyms Glial-Derived Neurotrophic Factor, ATF-1, MSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCEAAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDSLVYHILRKHSAKRCGCI

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P984651 - 2 µgIn Stock $99.25
08P984652 - 10 µgIn Stock $275.65
08P984653 - 1 mgIn Stock $6,615.00
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters