08P98457 MP BIOMEDICALS

Human GDF-15/MIC-1

from Cell Culture

98%, Determined by a cell inhibition assay using DU-145 cells. The expected ED50 for this effect is 1.0-2.0 μg/mL.

Synonyms MIC-1, Placental TGFβ, Prostate differentiation factor, ARNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P984571 - 5 µgIn Stock $99.25
08P984572 - 20 µgIn Stock $275.65
08P984573 - 1 mg Call for Price -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from Cell Culture
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters