08P98440 MP BIOMEDICALS

Recombinant Murine Flt3-Ligand

from E. Coli

98%, Determined by the dose-dependent stimulation of the proliferation of human AmL5 cells. The expected ED50 for this effect is 5.0 – 8.0 ng/mL.

Synonyms Fms-related tyrosine kinase 3 ligand, MTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQ

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P984401 - 2 µgIn Stock $99.25
08P984402 - 10 µgIn Stock $275.65
08P984403 - 1 mgIn Stock $4,299.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters