08P98431 MP BIOMEDICALS

Recombinant Murine FGF-acidic

from E. Coli

95%, Assay #1: The ED50 as determined by the dose-dependent stimulation of thymidine uptake by 3T3 cells in the presence of heparin is ≤ 0.5 ng/mL corresponding to a specific activity of ≥ 2 x 106 units/mg.

Assay #2: The ED50 was determined by a cell proliferation assay using balb/c 3T3 cells is ≤ 0.2 ng/mL in the presence of 10 μg/mL heparin, corresponding to a specific activity of ≥ 5 x 106 units/mg.

Synonyms Fibroblast Growth Factor-acidic, FGF-1, HBGF-1, ECGF-beta, MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P984311 - 10 µgIn Stock $99.25
08P984312 - 50 µgIn Stock $275.65
08P984313 - 1 mgIn Stock $1,901.80
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters