08P98391 MP BIOMEDICALS

Recombinant Human DKK-1

from HEK293 cells

97%, Determined by its ability to inhibit the proliferation of HCT116 colorectal carcinoma cells. Approximately 40% growth inhibition was achieved at a DKK-1 concentration of 200ng/mL.

Synonyms Dickkopf-related protein-1, Dickkopf-1, SK, TLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRH

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P983911 - 2 µgIn Stock $99.25
08P983912 - 10 µgIn Stock $275.65
08P983913 - 1 mg Call for Price -
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from HEK293 cells
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters