08P98387 MP BIOMEDICALS

Recombinant Human CTGFL/WISP-2

from E. Coli

95%, The ED50 was determined by its ability to inhibit IGF-II induced proliferation of MCF-7 is between 10-20 ng/mL in the presence of 15 ng/mL of human IGF-II.

Synonyms Connective Tissue Growth Factor-Like protein, CCN5, CT-58, MQLCPTPCTCPWPPPRCPLGVPLVLDGCGCCRVCARRLGEPCDQLHVCDASQGLVCQPGAGPGGRGALCLLAEDDSSCEVNGRLYREGETFQPHCSIRCRCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVLGKCCPEWVCGQGGGLGTQPLPAQGPQFSGLVSSLPPGVPCPEWSTAWGPCSTTCGLGMATRVSNQNRFCRLETQRRLCLSRPCPPSRGRSPQNSAF

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P983871 - 5 µgIn Stock $99.25
08P983872 - 20 µgIn Stock $275.65
08P983873 - 1 mgIn Stock $4,299.75
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters