08P98352 MP BIOMEDICALS

Recombinant Human BAFF Receptor

from E. Coli

95%, Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 2.0-4.0 μg/mL in the presence of 1.0μg/mL of human soluble BAFF.

Synonyms BAFFR, TNFRSF13C, MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG

Price and Availability

SKU-Pack Size Availability Price (USD) Quantity
08P983521 - 10 µgIn Stock $99.25
08P983522 - 50 µgIn Stock $275.65
08P983523 - 1 mgIn Stock $1,901.80
  • Purchase
  • Safety & Documentation
  • Protocols & References
  • Ratings & Reviews

Purchase

Safety & Documentation

Protocols & References

Ratings & Reviews

Ratings & Reviews

WRITE A REVIEW
from E. Coli
  • No references available for this product at this time.

FASTPREP FAMILY OF PRODUCTS

FastPrep-24 5G
Homogenizer
FastPrep-96
Homogenizer
MPure-12 Nucleic Acid
Purification System
Lysing
Beads and Tubes
DNA, RNA & Protein
Isolation Kits
FastPrep Homogenizer
Adapters